WFDC2_HUMAN Q14508
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q14508
Recommended name：WAP four-disulfide core domain protein 2
EC number：
Alternative names：(Epididymal secretory protein E4) (Major epididymis-specific protein E4) (Putative protease inhibitor WAP5)
Cleaved into：
GeneID：10406
Gene names (primary )：WFDC2
Gene names (synonym )：HE4 WAP5
Gene names (ORF )：
Length：124
Mass：12993
Sequence：MPACRLGPLAAALLLSLLLFGFTLVSGTGAEKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Tissue specificity：Expressed in a number of normal tissues, including male reproductive system, regions of the respiratory tract and nasopharynx. Highly expressed in a number of tumors cells lines, such ovarian, colon, breast, lung and renal cells lines. Initially described as being exclusively transcribed in the epididymis. {ECO:0000269|PubMed:15781627}.
Induction：
Developmental stage：
Protein families：