DNJB9_HUMAN Q9UBS3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UBS3
Recommended name：DnaJ homolog subfamily B member 9
EC number：
Alternative names：(Endoplasmic reticulum DNA J domain-containing protein 4) (ER-resident protein ERdj4) (ERdj4) (Microvascular endothelial differentiation gene 1 protein) (Mdg-1)
Cleaved into：
GeneID：4189
Gene names (primary )：DNAJB9
Gene names (synonym )：MDG1
Gene names (ORF )：UNQ743/PRO1471
Length：223
Mass：25518
Sequence：MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPDAEAKFREIAEAYETLSDANRRKEYDTLGHSAFTSGKGQRGSGSSFEQSFNFNFDDLFKDFGFFGQNQNTGSKKRFENHFQTRQDGGSSRQRHHFQEFSFGGGLFDDMFEDMEKMFSFSGFDSTNQHTVQTENRFHGSSKHCRTVTQRRGNMVTTYTDCSGQ
Tissue specificity：Widely expressed. Expressed at highest level in the liver, placenta and kidney (PubMed:11836248). {ECO:0000269|PubMed:11836248}.
Induction：
Developmental stage：
Protein families：