AGRE4_HUMAN   Q86SQ3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86SQ3

Recommended name:Putative adhesion G protein-coupled receptor E4P

EC number:

Alternative names:(EGF-like module receptor 4) (EGF-like module-containing mucin-like hormone receptor-like 4) (G-protein coupled receptor 127) (G-protein coupled receptor PGR16)

Cleaved into:

GeneID:

Gene names  (primary ):ADGRE4P

Gene names  (synonym ):EMR4 EMR4P GPR127 PGR16

Gene names  (ORF ):

Length:457

Mass:50903

Sequence:MGSRFLLVLLSGASCPPCPKYASCHNSTHCTCEDGFRARSGRTYFHDSSEKCEDINECETGLAKCKYKAYCRNKVGGYICSCLVKYTLFNFLAGIIDYDHPDCYENNSQGTTQSNVDIWVSGVKPGFGKQLPGDKRTKHICVYWEGSEGGWSTEGCSHVHSNGSYTKCKCFHLSSFAVLVALAPKEDPVLTVITQVGLTISLLCLFLAILTFLLCRPIQNTSTSLHLELSLCLFLAHLLFLTGINRTEPEVLCSIIAGLLHFLYLACFTWMLLEGLHLFLTVRNLKVANYTSTGRFKKRFMYPVGYGIPAVIIAVSAIVGPQNYGTFTCWLKLDKGFIWSFMGPVAVIILINLVFYFQVLWILRSKLSSLNKEVSTIQDTRVMTFKAISQLFILGCSWGLGFFMVEEVGKTIGSIIAYSFTIINTLQGVLLFVVHCLLNRQVRLIILSVISLVPKSN

Tissue specificity:

Induction:

Developmental stage:

Protein families:G-protein coupled receptor 2 family, Adhesion G-protein coupled receptor (ADGR) subfamily


   💬 WhatsApp