PLP2_HUMAN   Q04941


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q04941

Recommended name:Proteolipid protein 2

EC number:

Alternative names:(Differentiation-dependent protein A4) (Intestinal membrane A4 protein)

Cleaved into:

GeneID:5355

Gene names  (primary ):PLP2

Gene names  (synonym ):A4

Gene names  (ORF ):

Length:152

Mass:16691

Sequence:MADSERLSAPGCWAACTNFSRTRKGILLFAEIILCLVILICFSASTPGYSSLSVIEMILAAIFFVVYMCDLHTKIPFINWPWSDFFRTLIAAILYLITSIVVLVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Tissue specificity:Enriched in colonic mucosa. The expression of A4 follows a gradient along the crypto-villus axis with the most abundant message occurring in the lower half of the crypt.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp