TIM8A_HUMAN O60220
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O60220
Recommended name：Mitochondrial import inner membrane translocase subunit Tim8 A
EC number：
Alternative names：(Deafness dystonia protein 1) (X-linked deafness dystonia protein)
Cleaved into：
GeneID：1678
Gene names (primary )：TIMM8A
Gene names (synonym )：DDP DDP1 TIM8A
Gene names (ORF )：
Length：97
Mass：10998
Sequence：MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
Tissue specificity：Highly expressed in fetal and adult brain, followed by fetal lung, liver and kidney. Also expressed in heart, placenta, lung, liver, kidney, pancreas, skeletal muscle and heart.
Induction：
Developmental stage：
Protein families：Small Tim family