GA45G_HUMAN O95257
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95257
Recommended name：Growth arrest and DNA damage-inducible protein GADD45 gamma
EC number：
Alternative names：(Cytokine-responsive protein CR6) (DNA damage-inducible transcript 2 protein) (DDIT-2)
Cleaved into：
GeneID：10912
Gene names (primary )：GADD45G
Gene names (synonym )：CR6 DDIT2
Gene names (ORF )：
Length：159
Mass：17121
Sequence：MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Tissue specificity：
Induction：
Developmental stage：
Protein families：GADD45 family