CDN2C_HUMAN   P42773


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P42773

Recommended name:Cyclin-dependent kinase 4 inhibitor C

EC number:

Alternative names:(Cyclin-dependent kinase 6 inhibitor) (p18-INK4c) (p18-INK6)

Cleaved into:

GeneID:1031

Gene names  (primary ):CDKN2C

Gene names  (synonym ):CDKN6

Gene names  (ORF ):

Length:168

Mass:18127

Sequence:MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Tissue specificity:Highest levels found in skeletal muscle. Also found in pancreas and heart.

Induction:

Developmental stage:

Protein families:CDKN2 cyclin-dependent kinase inhibitor family


   💬 WhatsApp