CTAG2_HUMAN O75638
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O75638
Recommended name：Cancer/testis antigen 2
EC number：
Alternative names：(CT2) (Autoimmunogenic cancer/testis antigen NY-ESO-2) (Cancer/testis antigen 6.2) (CT6.2) (L antigen family member 1) (LAGE-1)
Cleaved into：
GeneID：30848
Gene names (primary )：CTAG2
Gene names (synonym )：ESO2 LAGE1
Gene names (ORF )：
Length：210
Mass：21090
Sequence：MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGAARASGPRGGAPRGPHGGAASAQDGRCPCGARRPDSRLLELHITMPFSSPMEAELVRRILSRDAAPLPRPGAVLKDFTVSGNLLFMSVRDQDREGAGRMRVVGWGLGSASPEGQKARDLRTPKHKVSEQRPGTPGPPPPEGAQGDGCRGVAFNVMFSAPHI
Tissue specificity：Testis and very low level in placenta and in some uterus samples. Observed in 25-50% of tumor samples of melanomas, non-small-cell lung carcinomas, bladder, prostate and head and neck cancers.
Induction：
Developmental stage：
Protein families：CTAG/PCC1 family