CEI_HUMAN   Q86SI9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q86SI9

Recommended name:Protein CEI

EC number:

Alternative names:(Coordinated expression to IRXA2 protein)

Cleaved into:

GeneID:153571

Gene names  (primary ):C5orf38

Gene names  (synonym ):CEI

Gene names  (ORF ):

Length:138

Mass:15091

Sequence:MVAPAARVFLRAVRAALTSTVPDLLCLLARGSPRGLASGRLPLAVHSAQHGPGSGAPWLRIARRALRFVLSKHWGDDCYLTNRLWQDLKPPSHVENGQELRLAPPVQWALQVQGNQLQTAVLCLRMAPPEPAGSRQRI

Tissue specificity:Isoform 1 is highly expressed in small intestine, testis and kidney, medium expressed in brain and heart and low expressed in colon; it could not be detected in liver, adrenal gland and pancreas. {ECO:0000269|PubMed:16515847}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp