IG2R_HUMAN P09565
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09565
Recommended name:Putative insulin-like growth factor 2-associated protein
EC number:
Alternative names:(Cell growth-inhibiting gene 44 protein) (Insulin-like growth factor II-associated protein)
Cleaved into:
GeneID:
Gene names (primary ):
Gene names (synonym ):
Gene names (ORF ):GIG44 PP9974
Length:113
Mass:12087
Sequence:MTPGVVHASPPQSQRVPRQAPCEWAIRNIGQKPKEPNCHNCGTHIGLRSKTLRGTPNYLPIRQDTHPPSVIFCLAGVGVPGGTCRPAPCVPRFAALPWATNHPGPGCLSDLRA
Tissue specificity:Expressed in fetal and adult liver. {ECO:0000269|PubMed:3167054}.
Induction:
Developmental stage:
Protein families: