KCMB1_HUMAN Q16558
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16558
Recommended name:Calcium-activated potassium channel subunit beta-1
EC number:
Alternative names:(BK channel subunit beta-1) (BKbeta) (BKbeta1) (Hbeta1) (Calcium-activated potassium channel, subfamily M subunit beta-1) (Calcium-activated potassium channel subunit beta) (Charybdotoxin receptor subunit beta-1) (K(VCA)beta-1) (Maxi K channel subunit beta-1) (Slo-beta-1) (Slo-beta)
Cleaved into:
GeneID:3779
Gene names (primary ):KCNMB1
Gene names (synonym ):
Gene names (ORF ):
Length:191
Mass:21797
Sequence:MVKKLVMAQKRGETRALCLGVTMVVCAVITYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQCSYIPGSVDNYQTARADVEKVRAKFQEQQVFYCFSAPRGNETSVLFQRLYGPQALLFSLFWPTFLLTGGLLIIAMVKSNQYLSILAAQK
Tissue specificity:Abundantly expressed in smooth muscle. Low levels of expression in most other tissues. Within the brain, relatively high levels found in hippocampus and corpus callosum.
Induction:
Developmental stage:
Protein families:KCNMB (TC 8.A.14.1) family, KCNMB1 subfamily