D130A_HUMAN   P0DP74


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0DP74

Recommended name:Beta-defensin 130A

EC number:

Alternative names:(Beta-defensin 130) (Beta-defensin 30) (DEFB-30) (Defensin, beta 130)

Cleaved into:

GeneID:100133267

Gene names  (primary ):DEFB130A

Gene names  (synonym ):DEFB130 DEFB30

Gene names  (ORF ):

Length:79

Mass:8736

Sequence:MKLHSLISVLLLFVTLIPKGKTGVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP

Tissue specificity:Expressed on differentiated macrophage phagocytizing plasmodium falciparum-parasitized erythrocytes. {ECO:0000269|PubMed:28181499}.

Induction:

Developmental stage:

Protein families:Beta-defensin family


   💬 WhatsApp