BAP31_HUMAN P51572
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51572
Recommended name：B-cell receptor-associated protein 31
EC number：
Alternative names：(BCR-associated protein 31) (Bap31) (6C6-AG tumor-associated antigen) (Protein CDM) (p28)
Cleaved into：
GeneID：10134
Gene names (primary )：BCAP31
Gene names (synonym )：BAP31 DXS1357E
Gene names (ORF )：
Length：246
Mass：27992
Sequence：MSLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELLVSYGNTFFVVLIVILVLLVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Tissue specificity：Ubiquitous. Highly expressed in neurons and discrete endocrine cells. {ECO:0000269|PubMed:11561007}.
Induction：
Developmental stage：
Protein families：BCAP29/BCAP31 family