UQCC1_HUMAN Q9NVA1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NVA1
Recommended name：Ubiquinol-cytochrome-c reductase complex assembly factor 1
EC number：
Alternative names：(Basic FGF-repressed Zic-binding protein) (bFGF-repressed Zic-binding protein) (bFZb) (Ubiquinol-cytochrome c reductase complex chaperone CBP3 homolog)
Cleaved into：
GeneID：55245
Gene names (primary )：UQCC1
Gene names (synonym )：BZFB C20orf44 UQCC
Gene names (ORF )：
Length：299
Mass：34600
Sequence：MALLVRVLRNQTSISQWVPVCSRLIPVSPTQGQGDRALSRTSQWPQMSQSRACGGSEQIPGIDIQLNRKYHTTRKLSTTKDSPQPVEEKVGAFTKIIEAMGFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMPDTFNSWFLITLLHVWMCLVRMKQEGRSGKYMCRIIVHFMWEDVQQRGRVMGVNPYILKKNMILMTNHFYAAILGYDEGILSDDHGLAAALWRTFFNRKCEDPRHLELLVEYVRKQIQYLDSMNGEDLLLTGEVSWRPLVEKNPQSILKPHSPTYNDEGL
Tissue specificity：
Induction：
Developmental stage：
Protein families：CBP3 family