UQCC3_HUMAN   Q6UW78


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UW78

Recommended name:Ubiquinol-cytochrome-c reductase complex assembly factor 3

EC number:

Alternative names:(Assembly factor CBP4 homolog)

Cleaved into:

GeneID:790955

Gene names  (primary ):UQCC3

Gene names  (synonym ):C11orf83

Gene names  (ORF ):UNQ655/PRO1286

Length:93

Mass:10081

Sequence:MDSLRKMLISVAMLGAGAGVGYALLVIVTPGERRKQEMLKEMPLQDPRSREEAARTQQLLLATLQEAATTQENVAWRKNWMVGGEGGAGGRSP

Tissue specificity:

Induction:

Developmental stage:

Protein families:UQCC3 family


   💬 WhatsApp