AR2BP_HUMAN   Q9Y2Y0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Y2Y0

Recommended name:ADP-ribosylation factor-like protein 2-binding protein

EC number:

Alternative names:(ARF-like 2-binding protein) (ARL2-binding protein) (Binder of ARF2 protein 1)

Cleaved into:

GeneID:23568

Gene names  (primary ):ARL2BP

Gene names  (synonym ):BART BART1

Gene names  (ORF ):

Length:163

Mass:18822

Sequence:MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Tissue specificity:Expressed in retina pigment epithelial cells (at protein level). Widely expressed. {ECO:0000269|PubMed:10488091, ECO:0000269|PubMed:23849777}.

Induction:

Developmental stage:

Protein families:ARL2BP family


   💬 WhatsApp