APOC1_HUMAN P02654
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02654
Recommended name：Apolipoprotein C-I
EC number：
Alternative names：(Apo-CI) (ApoC-I) (Apolipoprotein C1)
Cleaved into：Truncated apolipoprotein C-I
GeneID：341
Gene names (primary )：APOC1
Gene names (synonym )：
Gene names (ORF )：
Length：83
Mass：9332
Sequence：MRLFLSLPVLVVVLSIVLEGPAPAQGTPDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKIDS
Tissue specificity：Synthesized mainly in liver and to a minor degree in intestine. Also found in the lung and spleen. {ECO:0000269|PubMed:2835369}.
Induction：
Developmental stage：
Protein families：Apolipoprotein C1 family