MARE1_HUMAN   Q15691


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q15691

Recommended name:Microtubule-associated protein RP/EB family member 1

EC number:

Alternative names:(APC-binding protein EB1) (End-binding protein 1) (EB1)

Cleaved into:

GeneID:22919

Gene names  (primary ):MAPRE1

Gene names  (synonym ):

Gene names  (ORF ):

Length:268

Mass:29999

Sequence:MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

Tissue specificity:Ubiquitously expressed. {ECO:0000269|PubMed:10644998}.

Induction:

Developmental stage:

Protein families:MAPRE family


   💬 WhatsApp