SWAHD_HUMAN   A6NJG2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A6NJG2

Recommended name:Ankyrin repeat domain-containing protein SOWAHD

EC number:

Alternative names:(Ankyrin repeat domain-containing protein 58) (Protein sosondowah homolog D)

Cleaved into:

GeneID:347454

Gene names  (primary ):SOWAHD

Gene names  (synonym ):ANKRD58

Gene names  (ORF ):

Length:315

Mass:33803

Sequence:MAQLGGAANRAPTASLAPTSQSLRCAPQPRPSRADTGSLGRYWGKAAAAASREHPFPGTLMHSAAGSGRRRGALRELLGLQRAAPAGWLSEERAEELGGPSGPGSSRLCLEPREHAWILAAAEGRYEVLRELLEAEPELLLRGDPITGYSVLHWLAKHGRHEELILVHDFALRRGLRLDVSAPGSGGLTPLHLAALQGHDMVIKVLVGALGADATRRDHSGHRACHYLRPDAPWRLRELSGAEEWEMESGSGCTNLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSLFRHLFPSFQDR

Tissue specificity:

Induction:

Developmental stage:

Protein families:SOWAH family


   💬 WhatsApp