ULBP2_HUMAN   Q9BZM5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9BZM5

Recommended name:UL16-binding protein 2

EC number:

Alternative names:(ALCAN-alpha) (NKG2D ligand 2) (N2DL-2) (NKG2DL2) (Retinoic acid early transcript 1H)

Cleaved into:

GeneID:80328

Gene names  (primary ):ULBP2

Gene names  (synonym ):N2DL2 RAET1H

Gene names  (ORF ):UNQ463/PRO791

Length:246

Mass:27368

Sequence:MAAAAATKILLCLPLLLLLSGWSRAGRADPHSLCYDITVIPKFRPGPRWCAVQGQVDEKTFLHYDCGNKTVTPVSPLGKKLNVTTAWKAQNPVLREVVDILTEQLRDIQLENYTPKEPLTLQARMSCEQKAEGHSSGSWQFSFDGQIFLLFDSEKRMWTTVHPGARKMKEKWENDKVVAMSFHYFSMGDCIGWLEDFLMGMDSTLEPSAGAPLAMSSGTTQLRATATTLILCCLLIILPCFILPGI

Tissue specificity:Expressed in various types of cancer cell lines and in the fetus, but not in normal tissues. {ECO:0000269|PubMed:11444831}.

Induction:

Developmental stage:

Protein families:MHC class I family


   💬 WhatsApp