AB17C_HUMAN   Q6PCB6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6PCB6

Recommended name:Alpha/beta hydrolase domain-containing protein 17C

EC number:EC:3.1.2.22

Alternative names:(Abhydrolase domain-containing protein 17C)

Cleaved into:

GeneID:58489

Gene names  (primary ):ABHD17C

Gene names  (synonym ):FAM108C1

Gene names  (ORF ):

Length:329

Mass:35831

Sequence:MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGAGASAPAPAQATAAAAAAQPAPQQPEEGAGAGPGACSLHLSERADWQYSQRELDAVEVFFSRTARDNRLGCMFVRCAPSSRYTLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSEKNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYECAAVILHSPLMSGLRVAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWVEGAGHNDIELYAQYLERLKQFISHELPNS

Tissue specificity:

Induction:

Developmental stage:

Protein families:AB hydrolase superfamily, ABHD17 family


   💬 WhatsApp