CAMP_HUMAN   P49913


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P49913

Recommended name:Cathelicidin antimicrobial peptide

EC number:

Alternative names:(18 kDa cationic antimicrobial protein) (CAP-18) (hCAP-18)

Cleaved into:Antibacterial peptide FALL-39 (FALL-39 peptide antibiotic); Antibacterial peptide LL-37

GeneID:820

Gene names  (primary ):CAMP

Gene names  (synonym ):CAP18 FALL39

Gene names  (ORF ):HSD26

Length:170

Mass:19301

Sequence:MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Tissue specificity:Expressed in bone marrow and testis and neutrophils.

Induction:

Developmental stage:

Protein families:Cathelicidin family


   💬 WhatsApp