ZDH24_HUMAN   Q6UX98


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6UX98

Recommended name:Probable palmitoyltransferase ZDHHC24

EC number:EC:2.3.1.225

Alternative names:(Zinc finger DHHC domain-containing protein 24)

Cleaved into:

GeneID:254359

Gene names  (primary ):ZDHHC24

Gene names  (synonym ):

Gene names  (ORF ):UNQ2528/PRO6027

Length:284

Mass:30176

Sequence:MGQPWAAGSTDGAPAQLPLVLTALWAAAVGLELAYVLVLGPGPPPLGPLARALQLALAAFQLLNLLGNVGLFLRSDPSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFGNYRPFLCLLLHAAGVLLHVSVLLGPALSALLRAHTPLHMAALLLLPWLMLLTGRVSLAQFALAFVTDTCVAGALLCGAGLLFHGMLLLRGQTTWEWARGQHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTAS

Tissue specificity:

Induction:

Developmental stage:

Protein families:DHHC palmitoyltransferase family


   💬 WhatsApp