DR4L1_HUMAN   P0CG22


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0CG22

Recommended name:Putative dehydrogenase/reductase SDR family member 4-like 1

EC number:

Alternative names:(Short chain dehydrogenase/reductase family 25C member 4)

Cleaved into:

GeneID:

Gene names  (primary ):DHRS4L1

Gene names  (synonym ):SDR25C4

Gene names  (ORF ):

Length:281

Mass:30608

Sequence:MHKARLRGHCARAGKSVRLASSGMTRRDPLTNKVALVTASTDWIGFAVAQRLAQDGAHVVVSRRKQQNVDQAVATLQGEGLSMTGTVCHVGKMKDWERLVATAMKLHGVIDILSLSITNSKRGLFWFTLLQTAEEAWDRNLDINGKALALMIKAVVPEMEKRGGGSVGFLASVAAFRPLPGFSPYNVSKTALLGLNKTLAIELAPRNIRVNCLAPGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDSLGIVSFLCSEDASYLTGETVMVGGGTPSRL

Tissue specificity:

Induction:

Developmental stage:

Protein families:Short-chain dehydrogenases/reductases (SDR) family


   💬 WhatsApp