RN152_HUMAN   Q8N8N0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8N8N0

Recommended name:E3 ubiquitin-protein ligase RNF152

EC number:EC:2.3.2.27

Alternative names:(RING finger protein 152) (RING-type E3 ubiquitin transferase RNF152)

Cleaved into:

GeneID:220441

Gene names  (primary ):RNF152

Gene names  (synonym ):

Gene names  (ORF ):

Length:203

Mass:22357

Sequence:METLSQDSLLECQICFNYYSPRRRPKLLDCKHTCCSVCLQQMRTSQKDVRCPWCRGVTKLPPGFSVSQLPDDPEVLAVIAIPHTSEHTPVFIKLPSNGCYMLPLPISKERALLPGDMGCRLLPGSQQKSVTVVTIPAEQQPLQGGAPQEAVEEEQDRRGVVKSSTWSGVCTVILVACVLVFLLGIVLHNMSCISKRFTVISCG

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:21203937}.

Induction:

Developmental stage:

Protein families:RNF152 family


   💬 WhatsApp