RASH_HUMAN   P01112


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01112

Recommended name:GTPase HRas

EC number:EC:3.6.5.2

Alternative names:(H-Ras-1) (Ha-Ras) (Transforming protein p21) (c-H-ras) (p21ras)

Cleaved into:GTPase HRas, N-terminally processed

GeneID:3265

Gene names  (primary ):HRAS

Gene names  (synonym ):HRAS1

Gene names  (ORF ):

Length:189

Mass:21298

Sequence:MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

Tissue specificity:Widely expressed. {ECO:0000269|PubMed:14500341}.

Induction:

Developmental stage:

Protein families:Small GTPase superfamily, Ras family


   💬 WhatsApp