SIA7B_HUMAN   Q9UJ37


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UJ37

Recommended name:Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2

EC number:EC:2.4.99.3

Alternative names:(GalNAc alpha-2,6-sialyltransferase II) (ST6GalNAc II) (ST6GalNAcII) (SThM) (Sialyltransferase 7B) (SIAT7-B)

Cleaved into:

GeneID:10610

Gene names  (primary ):ST6GALNAC2

Gene names  (synonym ):SIAT7B SIATL1 STHM

Gene names  (ORF ):

Length:374

Mass:41939

Sequence:MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAVVGNGGILNGSRQGPNIDAHDYVFRLNGAVIKGFERDVGTKTSFYGFTVNTMKNSLVSYWNLGFTSVPQGQDLQYIFIPSDIRDYVMLRSAILGVPVPEGLDKGDRPHAYFGPEASASKFKLLHPDFISYLTERFLKSKLINTHFGDLYMPSTGALMLLTALHTCDQVSAYGFITSNYWKFSDHYFERKMKPLIFYANHDLSLEAALWRDLHKAGILQLYQR

Tissue specificity:Expressed in skeletal muscle, heart, kidney, placenta, lung and leukocytes. {ECO:0000269|PubMed:10742600}.

Induction:

Developmental stage:

Protein families:Glycosyltransferase 29 family


   💬 WhatsApp