DHDH_HUMAN   Q9UQ10


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9UQ10

Recommended name:Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase

EC number:EC:1.3.1.20

Alternative names:(D-xylose 1-dehydrogenase) (D-xylose-NADP dehydrogenase) (Dimeric dihydrodiol dehydrogenase) (Hum2DD)

Cleaved into:

GeneID:27294

Gene names  (primary ):DHDH

Gene names  (synonym ):2DD

Gene names  (ORF ):

Length:334

Mass:36382

Sequence:MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR

Tissue specificity:Small intestine. {ECO:0000269|PubMed:10477285}.

Induction:

Developmental stage:

Protein families:Gfo/Idh/MocA family


   💬 WhatsApp