C27C1_HUMAN   Q4G0S4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4G0S4

Recommended name:Cytochrome P450 27C1

EC number:EC:1.14.19.53

Alternative names:(All-trans retinol 3,4-desaturase)

Cleaved into:

GeneID:339761

Gene names  (primary ):CYP27C1

Gene names  (synonym ):

Gene names  (ORF ):

Length:372

Mass:42632

Sequence:MRSVLRQRILKPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEGVATILYESRLGCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFCRSWDGLFKFSQIHVDNKLRDIQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEMLLAGVDTTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLKETLRLFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDLDRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAVHAKTHGLLTPGGPIHVRFVNRK

Tissue specificity:Widely expressed, with highest levels in the liver, kidney and pancreas. {ECO:0000269|PubMed:16360114}.

Induction:

Developmental stage:

Protein families:Cytochrome P450 family


   💬 WhatsApp