MOGT3_HUMAN Q86VF5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q86VF5
Recommended name：2-acylglycerol O-acyltransferase 3
EC number：EC:2.3.1.20
Alternative names：(Acyl-CoA:monoacylglycerol acyltransferase 3) (MGAT3) (Diacylglycerol O-acyltransferase candidate 7) (hDC7) (Diacylglycerol acyltransferase 2-like protein 7) (Monoacylglycerol O-acyltransferase 3)
Cleaved into：
GeneID：346606
Gene names (primary )：MOGAT3
Gene names (synonym )：DC7 DGAT2L7
Gene names (ORF )：UNQ9383/PRO34208
Length：341
Mass：38730
Sequence：MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI
Tissue specificity：Selectively expressed in the digestive system. Highly expressed in the ileum, and at lower level in jejunum, duodenum, colon, cecum and the rectum. Not expressed in the stomach and the esophagus and trachea. Expressed at very low level in liver. {ECO:0000269|PubMed:12618427}.
Induction：
Developmental stage：
Protein families：Diacylglycerol acyltransferase family