NKX31_HUMAN Q99801
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99801
Recommended name：Homeobox protein Nkx-3.1
EC number：
Alternative names：(Homeobox protein NK-3 homolog A)
Cleaved into：
GeneID：4824
Gene names (primary )：NKX3-1
Gene names (synonym )：NKX3.1 NKX3A
Gene names (ORF )：
Length：234
Mass：26350
Sequence：MLRVPEPRPGEAKAEGAAPPTPSKPLTSFLIQDILRDGAQRQGGRTSSQRQRDPEPEPEPEPEGGRSRAGAQNDQLSTGPRAAPEEAETLAETEPERHLGSYLLDSENTSGALPRLPQTPKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
Tissue specificity：Highly expressed in the prostate and, at a lower level, in the testis. {ECO:0000269|PubMed:9226374, ECO:0000269|PubMed:9537602}.
Induction：By androgens and, in the LNCaP cell line, by estrogens. Androgenic control may be lost in prostate cancer cells during tumor progression from an androgen-dependent to an androgen-independent phase. {ECO:0000269|PubMed:11137288, ECO:0000269|PubMed:9226374, ECO:0000269|PubMed:9537602}.
Developmental stage：
Protein families：NK-3 homeobox family