LCE2B_HUMAN O14633
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O14633
Recommended name：Late cornified envelope protein 2B
EC number：
Alternative names：(Late envelope protein 10) (Skin-specific protein Xp5) (Small proline-rich-like epidermal differentiation complex protein 1B)
Cleaved into：
GeneID：26239
Gene names (primary )：LCE2B
Gene names (synonym )：LEP10 SPRL1B XP5
Gene names (ORF )：
Length：110
Mass：11219
Sequence：MSCQQNQQQCQPPPKCPPKCTPKCPPKCPPKCLPQCPAPCSPAVSSCCGPISGGCCGPSSGGCCNSGAGGCCLSHHRPRLFHRRRHQSPDCCESEPSGGSGCCHSSGGCC
Tissue specificity：Skin-specific. Expression was readily detected in adult trunk skin, adult arm skin, fetal skin, penal skin, vulva, esophagus and tongue. Not expressed in the cervix, rectum, lung, colon, or placenta. {ECO:0000269|PubMed:15854049, ECO:0000269|PubMed:9344646}.
Induction：By calcium and UVB. {ECO:0000269|PubMed:15854049}.
Developmental stage：
Protein families：LCE family