MICA_HUMAN Q29983
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q29983
Recommended name：MHC class I polypeptide-related sequence A
EC number：
Alternative names：(MIC-A)
Cleaved into：
GeneID：100507436
Gene names (primary )：MICA
Gene names (synonym )：PERB11.1
Gene names (ORF )：
Length：383
Mass：42915
Sequence：MGLGPVFLLLAGIFPFAPPGAAAEPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGPELVSLQVLDQHPVGTSDHRDATQLGFQPLMSDLGSTGSTEGA
Tissue specificity：Widely expressed with the exception of the central nervous system where it is absent. Expressed predominantly in gastric epithelium and also in monocytes, keratinocytes, endothelial cells, fibroblasts and in the outer layer of Hassal's corpuscles within the medulla of normal thymus. In skin, expressed mainly in the keratin layers, basal cells, ducts and follicles. Also expressed in many, but not all, epithelial tumors of lung, breast, kidney, ovary, prostate and colon. In thyomas, overexpressed in cortical and medullar epithelial cells. Tumors expressing MICA display increased levels of gamma delta T-cells. {ECO:0000269|PubMed:10359807, ECO:0000269|PubMed:10363723, ECO:0000269|PubMed:10691930, ECO:0000269|PubMed:12902493, ECO:0000269|PubMed:17565371, ECO:0000269|PubMed:8901601, ECO:0000269|PubMed:9396860}.
Induction：By heat shock, by infection with human cytomegalovirus (HCMV), human adenovirus 5, M.tuberculosis and diarrheagenic E.coli, and by exposure to DNA damaging conditions such as high doses of ionizing radiation, chromatin-modifying treatments and inhibitors of DNA replication. The HCMV UL142 protein causes down-regulation of the full-length protein but not of the truncated MICA*008 allele. {ECO:0000269|PubMed:11224526, ECO:0000269|PubMed:11485740, ECO:0000269|PubMed:11830641, ECO:0000269|PubMed:15995699, ECO:0000269|PubMed:16750166, ECO:0000269|PubMed:18287244, ECO:0000269|PubMed:8901601, ECO:0000269|PubMed:9497295}.
Developmental stage：
Protein families：MHC class I family, MIC subfamily