NMI_HUMAN   Q13287


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q13287

Recommended name:N-myc-interactor

EC number:

Alternative names:(Nmi) (N-myc and STAT interactor)

Cleaved into:

GeneID:9111

Gene names  (primary ):NMI

Gene names  (synonym ):

Gene names  (ORF ):

Length:307

Mass:35057

Sequence:MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE

Tissue specificity:Expressed in all adult and fetal tissues except brain and skin. More abundant in fetal tissues especially liver.

Induction:By IL2/interleukin-2 and IFNG/IFN-gamma.

Developmental stage:

Protein families:NMI family


   💬 WhatsApp