NMI_HUMAN Q13287
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q13287
Recommended name：N-myc-interactor
EC number：
Alternative names：(Nmi) (N-myc and STAT interactor)
Cleaved into：
GeneID：9111
Gene names (primary )：NMI
Gene names (synonym )：
Gene names (ORF )：
Length：307
Mass：35057
Sequence：MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVAQNVVSMSKHHVQIKDVNLEVTAKPVPLNSGVRFQVYVEVSKMKINVTEIPDTLREDQMRDKLELSFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQTCHRVTVSPYTEIHLKKYQIFSGTSKRTVLLTGMEGIQMDEEIVEDLINIHFQRAKNGGGEVDVVKCSLGQPHIAYFEE
Tissue specificity：Expressed in all adult and fetal tissues except brain and skin. More abundant in fetal tissues especially liver.
Induction：By IL2/interleukin-2 and IFNG/IFN-gamma.
Developmental stage：
Protein families：NMI family