DFB4A_HUMAN O15263
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O15263
Recommended name：Beta-defensin 4A
EC number：
Alternative names：(Beta-defensin 2) (BD-2) (hBD-2) (Defensin, beta 2) (Skin-antimicrobial peptide 1) (SAP1)
Cleaved into：
GeneID：100289462
Gene names (primary )：DEFB4A; DEFB4B
Gene names (synonym )：DEFB102 DEFB2 DEFB4;
Gene names (ORF )：;
Length：64
Mass：7038
Sequence：MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP
Tissue specificity：Expressed in the skin and respiratory tract.
Induction：By inflammation.
Developmental stage：
Protein families：Beta-defensin family, LAP/TAP subfamily