TIG1_HUMAN P49788
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49788
Recommended name：Retinoic acid receptor responder protein 1
EC number：
Alternative names：(Phorbol ester-induced gene 1 protein) (PERG-1) (RAR-responsive protein TIG1) (Tazarotene-induced gene 1 protein)
Cleaved into：
GeneID：5918
Gene names (primary )：RARRES1
Gene names (synonym )：PEIG1 TIG1
Gene names (ORF )：
Length：294
Mass：33285
Sequence：MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQQAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGEGRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDNHGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLHELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF
Tissue specificity：
Induction：By tazarotene and by all the retinoic acid receptors tested.
Developmental stage：
Protein families：Protease inhibitor I47 (latexin) family