ESRG_HUMAN Q1W209
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q1W209
Recommended name：Embryonic stem cell-related gene protein
EC number：
Alternative names：(hES cell-related gene protein)
Cleaved into：
GeneID：
Gene names (primary )：ESRG
Gene names (synonym )：HESRG
Gene names (ORF )：
Length：222
Mass：24186
Sequence：MTLFSDSARLHPGEINSLVAHTKPVWWSLHTDAHEIWCRDSDRGTSLGRSIPCPPALCSVRKIHLRPQVLRPTSPRNISPISNPVSGLFLLCSPTSLTIPQPLSPFNLGATLQSLPSLNFNSFHSLVETKETCFIREPKTPAPVTDWEGSLPLVFNHCRDASLISRFRPRRDACLGPSPLAASPAFLGQGQVPLNPFSFTLSGKSRFSGAGASTPQPLLLHP
Tissue specificity：Expressed only in fetal ovary and in undifferentiated ES cells. {ECO:0000269|PubMed:17803967, ECO:0000269|PubMed:23628413}.
Induction：Down-regulated during differentiation of ES cells. {ECO:0000269|PubMed:17803967}.
Developmental stage：
Protein families：