CI014_HUMAN P0C843
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C843
Recommended name：Putative uncharacterized protein encoded by LINC00032
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：LINC00032
Gene names (synonym )：C9orf14 NCRNA00032
Gene names (ORF )：
Length：101
Mass：12082
Sequence：MHLHVQPLRAKGKRPKDTFNKMAHRKRHSVTSEFLSKVPDEVRQRYINLFVEKYLKVCKTEDEAVYKAKIEKKAIYERCSRRNMYVNIAVNYLKKLRDQGA
Tissue specificity：
Induction：Down-regulated in late stage melanomas and ovarian cancer cell lines. {ECO:0000269|PubMed:17099875}.
Developmental stage：
Protein families：