SMYD2_HUMAN Q9NRG4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9NRG4
Recommended name：N-lysine methyltransferase SMYD2
EC number：EC:2.1.1.-
Alternative names：(HSKM-B) (Histone methyltransferase SMYD2) (Lysine N-methyltransferase 3C) (SET and MYND domain-containing protein 2)
Cleaved into：
GeneID：56950
Gene names (primary )：SMYD2
Gene names (synonym )：KMT3C
Gene names (ORF )：
Length：433
Mass：49688
Sequence：MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH
Tissue specificity：
Induction：Expression is repressed by CEBPA. {ECO:0000269|PubMed:17242690}.
Developmental stage：
Protein families：Class V-like SAM-binding methyltransferase superfamily