CDO1_HUMAN Q16878
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q16878
Recommended name：Cysteine dioxygenase type 1
EC number：EC:1.13.11.20
Alternative names：(Cysteine dioxygenase type I) (CDO) (CDO-I)
Cleaved into：
GeneID：1036
Gene names (primary )：CDO1
Gene names (synonym )：
Gene names (ORF )：
Length：200
Mass：22972
Sequence：MEQTEVLKPRTLADLIRILHQLFAGDEVNVEEVQAIMEAYESDPTEWAMYAKFDQYRYTRNLVDQGNGKFNLMILCWGEGHGSSIHDHTNSHCFLKMLQGNLKETLFAWPDKKSNEMVKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCHAFDQRTGHKNKVTMTFHSKFGIRTPNATSGSLENN
Tissue specificity：Highly expressed in liver and placenta. Low expression in heart, brain and pancreas. Also detected in hepatoblastoma Hep-G2 cells. {ECO:0000269|PubMed:10427686}.
Induction：In hepatoblastoma Hep-G2 cells, down-regulated by phorbol 12-myristate 13-acetate (PMA). {ECO:0000269|PubMed:10427686}.
Developmental stage：
Protein families：Cysteine dioxygenase family