G0S2_HUMAN   P27469


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P27469

Recommended name:G0/G1 switch protein 2

EC number:

Alternative names:(G0/G1 switch regulatory protein 2) (Putative lymphocyte G0/G1 switch gene)

Cleaved into:

GeneID:50486

Gene names  (primary ):G0S2

Gene names  (synonym ):

Gene names  (ORF ):

Length:103

Mass:11321

Sequence:METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLALFGVVLGLMETVCSPFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHAS

Tissue specificity:Widely expressed with highest levels in peripheral blood, skeletal muscle and heart, followed by kidney and liver. {ECO:0000269|PubMed:19706769}.

Induction:Induced by TNF through the activation of the NFKB pathway. {ECO:0000269|PubMed:19706769}.

Developmental stage:

Protein families:


   💬 WhatsApp