TSLP_HUMAN Q969D9
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q969D9
Recommended name：Thymic stromal lymphopoietin
EC number：
Alternative names：
Cleaved into：
GeneID：85480
Gene names (primary )：TSLP
Gene names (synonym )：
Gene names (ORF )：
Length：159
Mass：18141
Sequence：MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Tissue specificity：Isoform 1 is expressed in a number of tissues including heart, liver and prostate. Isoform 2 is the predominant form in keratinocytes of oral mucosa, skin and in salivary glands. It is secreted into saliva. {ECO:0000269|PubMed:11480573, ECO:0000269|PubMed:24850429}.
Induction：Released by primary epithelial cells in response to certain microbial products, physical injury, or inflammatory cytokines. {ECO:0000269|PubMed:17242164}.
Developmental stage：
Protein families：