CC85B_HUMAN Q15834
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q15834
Recommended name：Coiled-coil domain-containing protein 85B
EC number：
Alternative names：(Hepatitis delta antigen-interacting protein A) (Delta-interacting protein A)
Cleaved into：
GeneID：11007
Gene names (primary )：CCDC85B
Gene names (synonym )：DIPA
Gene names (ORF )：
Length：202
Mass：22091
Sequence：MEAEAGGLEELTDEEMAALGKEELVRRLRREEAARLAALVQRGRLMQEVNRQLQGHLGEIRELKQLNRRLQAENRELRDLCCFLDSERQRGRRAARQWQLFGTQASRAVREDLGGCWQKLAELEGRQEELLRENLALKELCLALGEEWGPRGGPSGAGGSGAGPAPELALPPCGPRDLGDGSSSTGSVGSPDQLPLACSPDD
Tissue specificity：Widely expressed including liver.
Induction：Up-regulated by doxorubicin. {ECO:0000269|PubMed:17873903}.
Developmental stage：
Protein families：CCDC85 family