CEMP1_HUMAN Q6PRD7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6PRD7
Recommended name：Cementoblastoma-derived protein 1
EC number：
Alternative names：(Cementum protein 1) (Cementum protein 23) (CP-23)
Cleaved into：
GeneID：752014
Gene names (primary )：CEMP1
Gene names (synonym )：
Gene names (ORF )：
Length：247
Mass：25959
Sequence：MGTSSTDSQQAGHRRCSTSNTSAENLTCLSLPGSPGKTAPLPGPAQAGAGQPLPKGCAAVKAEVGIPAPHTSQEVRIHIRRLLSWAAPGACGLRSTPCALPQALPQARPCPGRWFFPGCSLPTGGAQTILSLWTWRHFLNWALQQREENSGRARRVPPVPRTAPVSKGEGSHPPQNSNGEKVKTITPDVGLHQSLTSDPTVAVLRAKRAPEAHPPRSCSGSLTARVCHMGVCQGQGDTEDGRMTLMG
Tissue specificity：Expressed by cementoblasts, a subpopulation of periodontal ligament cells and cells located around vessels in periodontium (at protein level). {ECO:0000269|PubMed:16263347, ECO:0000269|PubMed:21465469}.
Induction：Up-regulated by hypoxia (at protein level). {ECO:0000269|PubMed:24117017}.
Developmental stage：
Protein families：