GCSAM_HUMAN Q8N6F7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8N6F7
Recommended name：Germinal center-associated signaling and motility protein
EC number：
Alternative names：(Germinal center B-cell-expressed transcript 2 protein) (Germinal center-associated lymphoma protein) (hGAL)
Cleaved into：
GeneID：257144
Gene names (primary )：GCSAM
Gene names (synonym )：GAL GCET2
Gene names (ORF )：
Length：178
Mass：21005
Sequence：MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL
Tissue specificity：Expressed in diffuse large B-cell lymphoma (DLBCL) and several germinal center (GC)-like lymphoma cell lines (at protein level). Highly expressed in normal GC lymphocytes and GC-derived malignancies. Expressed in thymus and spleen. {ECO:0000269|PubMed:12509382, ECO:0000269|PubMed:12819018, ECO:0000269|PubMed:15677569}.
Induction：Up-regulated by IL4/interleukin-4. {ECO:0000269|PubMed:12509382}.
Developmental stage：
Protein families：