ZN580_HUMAN Q9UK33
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9UK33
Recommended name：Zinc finger protein 580
EC number：
Alternative names：(LDL-induced EC protein)
Cleaved into：
GeneID：51157
Gene names (primary )：ZNF580
Gene names (synonym )：
Gene names (ORF )：
Length：172
Mass：18756
Sequence：MLLLPPRPPHPRSSSPEAMDPPPPKAPPFPKAEGPSSTPSSAAGPRPPRLGRHLLIDANGVPYTYTVQLEEEPRGPPQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLSRHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRLH
Tissue specificity：Expressed in endothelial cells. {ECO:0000269|PubMed:21599657}.
Induction：Up-regulated in presence of reactive oxygen species (ROS), like H(2)O(2), through the NF-kappaB signaling pathway. Up-regulated by sphingosine-1-phosphate (SP1) through the p38 MAPK signaling pathway (at protein level). {ECO:0000269|PubMed:20382120, ECO:0000269|PubMed:21830064}.
Developmental stage：
Protein families：