MRES1_HUMAN   Q9P0P8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9P0P8

Recommended name:Mitochondrial transcription rescue factor 1

EC number:

Alternative names:

Cleaved into:

GeneID:51250

Gene names  (primary ):MTRES1

Gene names  (synonym ):C6orf203

Gene names  (ORF ):HSPC230

Length:240

Mass:27941

Sequence:MAMASVKLLAGVLRKPDAWIGLWGVLRGTPSSYKLCTSWNRYLYFSSTKLRAPNYKTLFYNIFSLRLPGLLLSPECIFPFSVRLKSNIRSTKSTKKSLQKVDEEDSDEESHHDEMSEQEEELEDDPTVVKNYKDLEKAVQSFRYDVVLKTGLDIGRNKVEDAFYKGELRLNEEKLWKKSRTVKVGDTLDLLIGEDKEAGTETVMRILLKKVFEEKTESEKYRVVLRRWKSLKLPKKRMSK

Tissue specificity:

Induction:Up-regulated upon depletion of mitochondrial nucleic acids. {ECO:0000269|PubMed:31226201}.

Developmental stage:

Protein families:


   💬 WhatsApp