SG3A2_HUMAN Q96PL1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q96PL1
Recommended name：Secretoglobin family 3A member 2
EC number：
Alternative names：(Pneumo secretory protein 1) (PnSP-1) (Uteroglobin-related protein 1)
Cleaved into：
GeneID：117156
Gene names (primary )：SCGB3A2
Gene names (synonym )：PNSP1 UGRP1
Gene names (ORF )：UNQ566/PRO1128
Length：93
Mass：10161
Sequence：MKLVTIFLLVTISLCSYSATAFLINKVPLPVDKLAPLPLDNILPFMDPLKLLLKTLGISVEHLVEGLRKCVNELGPEASEAVKKLLEALSHLV
Tissue specificity：Highly expressed in lung and trachea (PubMed:12406855, PubMed:12175512, PubMed:12847263). Detected throughout the airway epithelium in lung, with slightly higher expression in large airways (PubMed:12406855). Found in lung submucosal gland acinus where it localizes to serous-like cells (PubMed:12406855). Probably expressed in club/Clara cells of the bronchioles (PubMed:12847263). Not detected in other tissues tested (PubMed:12847263). {ECO:0000269|PubMed:12175512, ECO:0000269|PubMed:12406855, ECO:0000269|PubMed:12847263}.
Induction：
Developmental stage：Expressed in fetal lung. {ECO:0000269|PubMed:12175512}.
Protein families：Secretoglobin family, UGRP subfamily