SIA4C_HUMAN   Q11206


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q11206

Recommended name:CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 4

EC number:EC:2.4.99.2

Alternative names:(Alpha 2,3-ST 4) (Beta-galactoside alpha-2,3-sialyltransferase 4) (Alpha 2,3-sialyltransferase IV) (Gal-NAc6S) (Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase) (Gal-beta-1,4-GlcNAc-alpha-2,3-sialyltransferase) (N-acetyllactosaminide alpha-2,3-sialyltransferase) (SAT-3) (ST-4) (ST3Gal IV) (ST3GalIV) (ST3GalA.2) (STZ) (Sialyltransferase 4C) (SIAT4-C)

Cleaved into:

GeneID:6484

Gene names  (primary ):ST3GAL4

Gene names  (synonym ):CGS23 NANTA3 SIAT4C STZ

Gene names  (ORF ):

Length:333

Mass:38045

Sequence:MVSKSRWKLLAMLALVLVVMVWYSISREDRYIELFYFPIPEKKEPCLQGEAESKASKLFGNYSRDQPIFLRLEDYFWVKTPSAYELPYGTKGSEDLLLRVLAITSSSIPKNIQSLRCRRCVVVGNGHRLRNSSLGDAINKYDVVIRLNNAPVAGYEGDVGSKTTMRLFYPESAHFDPKVENNPDTLLVLVAFKAMDFHWIETILSDKKRVRKGFWKQPPLIWDVNPKQIRILNPFFMEIAADKLLSLPMQQPRKIKQKPTTGLLAITLALHLCDLVHIAGFGYPDAYNKKQTIHYYEQITLKSMAGSGHNVSQEALAIKRMLEMGAIKNLTSF

Tissue specificity:Highly expressed in adult placenta, heart and kidney. {ECO:0000269|PubMed:8288606}.

Induction:

Developmental stage:Expressed in fetal tissues, with highest levels in heart, lung, and kidney. {ECO:0000269|PubMed:8288606}.

Protein families:Glycosyltransferase 29 family


   💬 WhatsApp