EDF1_HUMAN O60869
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O60869
Recommended name：Endothelial differentiation-related factor 1
EC number：
Alternative names：(EDF-1) (Multiprotein-bridging factor 1) (MBF1)
Cleaved into：
GeneID：8721
Gene names (primary )：EDF1
Gene names (synonym )：
Gene names (ORF )：
Length：148
Mass：16369
Sequence：MAESDWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAKLDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQVLGKIERAIGLKLRGKDIGKPIEKGPRAK
Tissue specificity：Expressed in brain, liver, lung, kidney and heart (at protein level). Ubiquitously expressed. More abundant in heart, pancreas, liver, intestine and adipose tissues. {ECO:0000269|PubMed:10567391, ECO:0000269|PubMed:12040021, ECO:0000269|PubMed:9813014}.
Induction：Down-regulated by HIV-1 Tat or phorbol ester (TPA) treatment in endothelial cells (at mRNA and protein levels). {ECO:0000269|PubMed:9813014}.
Developmental stage：Expressed in fetal tissues. More abundant in kidney. {ECO:0000269|PubMed:9813014}.
Protein families：